Research reportAmyloid-β peptide activates cultured astrocytes: morphological alterations, cytokine induction and nitric oxide release
Introduction
Alzheimer's disease (AD) is a neurodegenerative disorder characterized by a progressive cognitive decline resulting from selective neuronal dysfunction, synaptic loss, and neuronal cell death. The well-studied neuropathological features of AD include: loss of neurons; formation of intra-neuronal neurofibrillary tangles composed of paired helical filaments of the cytoskeletal protein tau; and extracellular plaques composed primarily of diffuse or compacted deposits of amyloid-β (Aβ) aggregates, with or without a component of dystrophic neurites 41, 46. What has been less well appreciated are the characteristic changes seen in glial cells in AD, and the role that these cells may play in the neurodegenerative cascade leading to Alzheimer dementia. One common feature of a variety of neurodegenerative disorders is the presence of large numbers of activated astrocytes and microglia (gliosis). Glial activation involves morphological changes (more spherical cell soma, hypertrophy of nuclei, appearance of extensive cellular processes) and changes in expression of a large number of proteins (for review, see Ref. [9]). In AD, activated astrocytes surround the neuritic shell of the amyloid plaque, and activated microglia are near the center of the neuritic shell adjacent to the amyloid core (for reviews, see Refs. 14, 28).
There are a number of stimuli that lead to glial activation. One of the best recognized inducers of glial activation is neuronal dysfunction or injury. For example, upon traumatic brain injury or experimentally induced central nervous system lesions, there is a rapid and vigorous glial activation response which is transient and reversible. However, in a number of diseases, glial cells remain in a chronic state of activation. For example, gliosis is a common feature of a number of neurodegenerative conditions, including sustained brain trauma, vascular insufficiency, AIDS, scrapie, Down syndrome, Pick's disease, and AD (for reviews, see Refs. 14, 28, 30).
The role of glial activation in AD is not known, although reactive glia have been reported to be associated with amyloid plaques at relatively early stages of the disease before the appearance of neuritic plaque components 6, 15, 29. In addition, several cytokines and inflammatory mediators produced by activated glia have the potential to initiate or exacerbate the progression of neuropathology (for reviews, see Refs. 3, 6, 14, 26, 33). Therefore, understanding the mechanisms by which glia become reactive and deciphering the regulatory pathways involved are important to begin to elucidate the contribution of glia to the neurodegenerative progression in AD. The factors responsible for inducing and maintaining the glial activation state in AD are unknown. However, because of the proximity of reactive glia to the amyloid plaques in AD, one possibility is that Aβ is involved in this process. There are numerous studies demonstrating that Aβ can be directly neurotoxic and can increase neuronal susceptibility to other toxic agents (for reviews, see Refs. 5, 48). However, the actions of Aβ on glia, the supramolecular forms of Aβ that affect glia, and the glial responses to Aβ exposure are less well studied.
As an initial approach to defining the interactions between Aβ and glia, we examined the effects of synthetic Aβ peptides on cultured astrocytes. We tested different Aβ peptides (Aβ 1–42, Aβ 17–42, and a scrambled Aβ 1–42) aggregated under a variety of conditions. We report here that Aβ 1–42 induces a robust astrocyte activation, as evidenced by morphological changes, upregulation of the cytokine interleukin-1β (IL-1β) mRNA, and stimulation of inducible nitric oxide synthase (iNOS) mRNA and nitric oxide (NO) release. We also report that a supernatant fraction containing globular Aβ oligomers is biologically active.
Section snippets
Aβ peptide synthesis, purification, and aggregation
Synthetic Aβ peptides Aβ 1–42, Aβ 17–42, and a scrambled Aβ 1–42 (KVKGLIDGAHIGDLVYEFMDSNSAIFREGVGAGHVHVAQVEF) were synthesized on an Applied Biosystems (Foster City, CA) 430A or Advanced Chemtech (Louisville, KY) 357 peptide synthesizer as previously described [44]. Briefly, Fmoc chemistry using dicyclohexylcarbodiimide-catalyzed formation of 1-hydroxytriazole active ester in N-methylpyrolidone (NMP) and dichloromethane (DCM) co-solvent was employed for coupling, and each residue was double
Morphological activation of astrocytes
After incubation in serum-free media containing N2 supplements for 24 h, astrocytes were flat and polygonal-shaped and growing in a monolayer, a typical morphology in culture. As previously reported [20], these astrocyte cultures are approximately 98% astrocytes, as assessed by positive staining for the astrocyte intermediate filament protein, glial fibrillary acidic protein (GFAP). Addition of aggregated (37°C for 5 days) Aβ 1–42 peptide to the cultures induced a marked morphological change.
Discussion
Our results clearly show that Aβ 1–42 induces glial activation, as shown by changes in cell morphology consistent with a reactive phenotype, induction of the cytokine IL-1β, and stimulation of iNOS mRNA and NO release. In addition, an active form of the Aβ 1–42 is found in the soluble fraction of the aggregated peptide. Altogether, our data suggest that non-fibrillar oligomeric assemblies of Aβ 1–42 are active in triggering cellular responses leading to glial activation, which in turn can lead
Acknowledgements
These studies were supported in part by NiH grants AG13939 (to LVE) AG13496 (to GAK) and AG15501 (to GAK and LVE). We thank Drs. D.M. Watterson, T.J. Lukas, U. Slomcznska, L.M. Zhou, and C. Edwards for assistance with peptide production, and Dr. E. Turkington for assistance with astrocyte cultures.
References (48)
- et al.
Astrocytosis, beta A4-protein deposition and paired helical filament formation in Alzheimer's disease
J. Neurol. Sci.
(1992) - et al.
Beta-amyloid of Alzheimer's disease induces reactive gliosis that inhibits axonal outgrowth
Exp. Neurol.
(1993) - et al.
Beta-amyloid converts an acute phase injury response to chronic injury responses
Neurobiol. Aging
(1996) - et al.
Expression of the Alzheimer amyloid-promoting factor antichymotrypsin is induced in human astrocytes by IL-1
Neuron
(1995) - et al.
Reciprocal control of inflammatory cytokines, IL-1 and IL-6, and beta-amyloid production in cultures
Neurosci. Lett.
(1995) - et al.
Molecular profile of reactive astrocytes-implications for their role in neurologic disease
Neuroscience
(1993) - et al.
Regulation of beta-amyloid precursor protein isoform mRNAs by transforming growth factor-beta 1 and interleukin-1 beta in astrocytes
Mol. Brain Res.
(1993) - et al.
Regional differences in reactive gliosis induced by substrate-bound beta-amyloid
Exp. Neurol.
(1994) - et al.
S100β induces apoptotic cell death in cultured astrocytes via a nitric oxide-dependent pathway
Biochim. Biophys. Acta
(1996) - et al.
S100β stimulates inducible nitric oxide synthase activity and mRNA levels in rat cortical astrocytes
J. Biol. Chem.
(1996)
Protein measurement with the folin phenol reagent
J. Biol. Chem.
The inflammatory response system of brain: implications for therapy of Alzheimer and other neurodegenerative diseases
Brain Res. Rev.
Glial cytokines in Alzheimer's disease: review and pathogenic implications
Human Pathol.
Clustering (apoJ) alters the aggregation of amyloid beta-peptide (Aβ 1–42) and forms slowly sedimenting Aβ complexes that cause oxidative stress
Exp. Neurol.
Inflammatory mechanisms in neurodegeneration and Alzheimer's disease: the role of the complement system
Neurobiol. Aging
Beta-amyloid-induced changes in cultured astrocytes parallel reactive astrocytosis associated with senile plaques in Alzheimer's disease
Neuroscience
Beta-amyloid increases enzyme activity and protein levels of glutamine synthetase in cultured astrocytes
Exp. Neurol.
Morphology and toxicity of Aβ-(1–42) dimer derived from neuritic and vascular amyloid deposits of Alzheimer's disease
J. Biol. Chem.
Synergistic induction of nitric oxide by beta-amyloid and cytokines in astrocytes
Biochem. Biophys. Res. Commun.
The molecular pathology of Alzheimer's disease
Neuron
In vivo and in vitro evidence supporting a role for the inflammatory cytokine interleukin-1 as a driving force in Alzheimer pathogenesis
Neurobiol. Aging
Evidence for apoptotic cell death in Alzheimer's disease
Exp. Neurol.
Amyloid-beta aggregation: selective inhibition of aggregation in mixtures of amyloid with different chain lengths
Biophys. J.
Neuropathological changes in Alzheimer disease
Prog. Brain Res.
Cited by (288)
Network analysis of S-nitrosylated synaptic proteins demonstrates unique roles in health and disease
2024, Biochimica et Biophysica Acta - Molecular Cell ResearchUPLC-Q-TOF/MS based serum and urine metabolomics strategy to analyze the mechanism of nervonic acid in treating Alzheimer's disease
2024, Journal of Pharmaceutical and Biomedical AnalysisThe shared role of cholesterol in neuronal and peripheral inflammation
2023, Pharmacology and TherapeuticsAnti-Amyloid Immunotherapies for Alzheimer’s Disease: A 2023 Clinical Update
2023, Neurotherapeutics
- 1
These authors contributed equally to this work.